(data stored in ACNUC7421 zone)

EMBL: CP001349.PE81

CP001349.PE81        Location/Qualifiers
FT   CDS             90204..90302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55133"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55133.1"
FT                   /translation="MCSFGVDGNIAPDVALTGASPYHLLHNGFTVS"
     MCSFGVDGNI APDVALTGAS PYHLLHNGFT VS                                      32

If you have problems or comments...

PBIL Back to PBIL home page