(data stored in ACNUC7421 zone)

EMBL: CP001349.PE84

CP001349.PE84        Location/Qualifiers
FT   CDS             91955..92227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55136"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU91"
FT                   /inference="similar to AA sequence:KEGG:M446_0718"
FT                   /protein_id="ACL55136.1"
FT                   /translation="MKRTIMLLAAATLMGSAAYAAEEGAAAGAAAGAAVGGPVGAAVGA
FT                   GVGHAATGPDRTGTVIERRSGCSHTTVRKENDVGESKTVHREDCD"
     MKRTIMLLAA ATLMGSAAYA AEEGAAAGAA AGAAVGGPVG AAVGAGVGHA ATGPDRTGTV        60
     IERRSGCSHT TVRKENDVGE SKTVHREDCD                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page