(data stored in ACNUC7421 zone)

EMBL: CP001349.PE85

CP001349.PE85        Location/Qualifiers
FT   CDS             92845..93063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55137"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU92"
FT                   /inference="similar to AA sequence:KEGG:M446_6754"
FT                   /protein_id="ACL55137.1"
FT                   /translation="MLVFLNDTLLSVVTQLRNSVGEEFAGRWFIEAGFGPCSRTPSQVF
FT                   DTAEDAMQWVRGCLEEDATVWEHEAVA"
     MLVFLNDTLL SVVTQLRNSV GEEFAGRWFI EAGFGPCSRT PSQVFDTAED AMQWVRGCLE        60
     EDATVWEHEA VA                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page