(data stored in ACNUC7421 zone)

EMBL: CP001349.PE86

CP001349.PE86        Location/Qualifiers
FT   CDS             complement(93415..95358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0089"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; SMART: Tetratricopeptide
FT                   domain protein; KEGG: met:M446_0534 adenylate/guanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55138"
FT                   /db_xref="GOA:B8IU93"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU93"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55138.1"
FT                   /translation="MDQTIADRRLVTILVADVVGYSRLIGADETGTLRRLKALRRDVIG
FT                   PSIAASKGRIIKTVGDGFIAEFGSAVRAVNCAISIQQGLARHEAGIAEDRALRLRIGIN
FT                   LGDVVVEPDGDLYGDGVNVAARLEPLSEAGGICLSRSVYDQVRDKLRYPFQDRGKLELK
FT                   NIARPVGVFSLPASAIADLTDTDEQVPEPVKTSNRKPWKATAVGAGFLTLLAAGGLGWW
FT                   SWTASKAPAPNQTIAAKLAGETREAPRLSIVVLPFSNLSNDPEQDYFADSITEDLTTDL
FT                   SHLAGSFVIARNTAFTYKNKPVDVKQIGRELGVRYVLEGSVRRTGEKVVLNSQLISAET
FT                   GAHIWSDRFDGDRSRLGDLQVEFVARLARSLDVQLTEAESLRSFRERPVNLDASDLAMR
FT                   GWASLNKQRSVANNNEAVQYFSQALKLDPNLPRAVLGLSRALMNKVINRWSEDIQADIE
FT                   GSDGLITKYIEKFPSDAAALVVKGDVFRSNKHFDAALAMYDAAIVANRNFAAAYALKGH
FT                   VSLLSGKAYAAIPSEIEAIRISPRDPLVNVWYYFVCHAHTHMAQWEEAIAWCNKCVAIS
FT                   PFWQAYIDLAAAYAWTGRAYEAKAAVSELLKLMPGYTVKKWATAGWSNHSRFLEEYQLI
FT                   VEGLRKAGLQEE"
     MDQTIADRRL VTILVADVVG YSRLIGADET GTLRRLKALR RDVIGPSIAA SKGRIIKTVG        60
     DGFIAEFGSA VRAVNCAISI QQGLARHEAG IAEDRALRLR IGINLGDVVV EPDGDLYGDG       120
     VNVAARLEPL SEAGGICLSR SVYDQVRDKL RYPFQDRGKL ELKNIARPVG VFSLPASAIA       180
     DLTDTDEQVP EPVKTSNRKP WKATAVGAGF LTLLAAGGLG WWSWTASKAP APNQTIAAKL       240
     AGETREAPRL SIVVLPFSNL SNDPEQDYFA DSITEDLTTD LSHLAGSFVI ARNTAFTYKN       300
     KPVDVKQIGR ELGVRYVLEG SVRRTGEKVV LNSQLISAET GAHIWSDRFD GDRSRLGDLQ       360
     VEFVARLARS LDVQLTEAES LRSFRERPVN LDASDLAMRG WASLNKQRSV ANNNEAVQYF       420
     SQALKLDPNL PRAVLGLSRA LMNKVINRWS EDIQADIEGS DGLITKYIEK FPSDAAALVV       480
     KGDVFRSNKH FDAALAMYDA AIVANRNFAA AYALKGHVSL LSGKAYAAIP SEIEAIRISP       540
     RDPLVNVWYY FVCHAHTHMA QWEEAIAWCN KCVAISPFWQ AYIDLAAAYA WTGRAYEAKA       600
     AVSELLKLMP GYTVKKWATA GWSNHSRFLE EYQLIVEGLR KAGLQEE                     647
//

If you have problems or comments...

PBIL Back to PBIL home page