(data stored in ACNUC7421 zone)

EMBL: CP001349.PE89

CP001349.PE89        Location/Qualifiers
FT   CDS             97100..97657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_3536 helix-turn-helix
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55141"
FT                   /db_xref="GOA:B8IU96"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55141.1"
FT                   /translation="MYINWSKPVSGPDGVPIPTYGNYGGPGYSNGEILSSPNQSVDYSA
FT                   TPVDALDSLFRAHDMVYDSPSTLVRAEGDLALIMGIEHLSQTPMSGEESLYAGAALIFA
FT                   VEQLTVTNGHPELLSARQLAAAATTSEHDIAYGLTHLDPSDVAGGAGLLAHSAESITAD
FT                   VLSHEAFPSFVSGLMSPLHNSI"
     MYINWSKPVS GPDGVPIPTY GNYGGPGYSN GEILSSPNQS VDYSATPVDA LDSLFRAHDM        60
     VYDSPSTLVR AEGDLALIMG IEHLSQTPMS GEESLYAGAA LIFAVEQLTV TNGHPELLSA       120
     RQLAAAATTS EHDIAYGLTH LDPSDVAGGA GLLAHSAESI TADVLSHEAF PSFVSGLMSP       180
     LHNSI                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page