(data stored in ACNUC7421 zone)

EMBL: CP001349.PE9

CP001349.PE9         Location/Qualifiers
FT   CDS             12622..13137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0010"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   mrd:Mrad2831_1125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55061"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ9"
FT                   /inference="protein motif:PFAM:PF01724"
FT                   /protein_id="ACL55061.1"
FT                   /translation="MDQPPLYEEDIVTWAEQQASALRSLAARPDLSNALDWDAVAEEIE
FT                   EVGASRIRATASALLLVLVHVLKYVSAPTAQSTRSWRAEVITFQTAARGLYTRSTRQRI
FT                   DWDDLWRSAKRNADASLHIHGDSLIEGLPEQMPFTPEELVAPDFDMDAALSRLGPLLAP
FT                   TGGRRRPT"
     MDQPPLYEED IVTWAEQQAS ALRSLAARPD LSNALDWDAV AEEIEEVGAS RIRATASALL        60
     LVLVHVLKYV SAPTAQSTRS WRAEVITFQT AARGLYTRST RQRIDWDDLW RSAKRNADAS       120
     LHIHGDSLIE GLPEQMPFTP EELVAPDFDM DAALSRLGPL LAPTGGRRRP T                171
//

If you have problems or comments...

PBIL Back to PBIL home page