(data stored in ACNUC7421 zone)

EMBL: CP001349.PE91

CP001349.PE91        Location/Qualifiers
FT   CDS             99795..100073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55143"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55143.1"
FT                   /translation="MILPPHLHVEEGRSRARSRWFSVRHENLRANDVDPECNGLKLTGI
FT                   TGSELGKVALGKLSLVSKGDITNPKDEPRKSAWREDRYVPESIPLLR"
     MILPPHLHVE EGRSRARSRW FSVRHENLRA NDVDPECNGL KLTGITGSEL GKVALGKLSL        60
     VSKGDITNPK DEPRKSAWRE DRYVPESIPL LR                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page