(data stored in ACNUC7421 zone)

EMBL: CP001349.PE92

CP001349.PE92        Location/Qualifiers
FT   CDS             complement(100201..102144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0096"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: met:M446_0534 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55144"
FT                   /db_xref="GOA:B8IU99"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU99"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55144.1"
FT                   /translation="MGRTITDRRLVTILVADVVSYSRLIGADETGTLRRLKALRRDVID
FT                   PSVTSVHGRIIKTMGGGFIAEFASAVRAVSCAVTIQQGLARHEAEIPDDRALRLRIGIN
FT                   LGDVVVEPDGDLYGDGVNVAARLEPLAEPGGICIARSVYDQVRDNLRYPFQDRGELELK
FT                   NIARPVGVYFLSASAIVGLAGTDEQAPEPVKTSNRKPWKATAVGAGFLTLLAAGGLGWW
FT                   SWTASKAPAPNQTIAAKLAGETREAPRLSIVVLPFSNLSNDPEQDYFADSITEDLTTDL
FT                   SHLAGSFVIARNTAFTYKNKPVGVKQIGQELGVRYVLEGSVRRSGERVVVSAELISAET
FT                   GAQIWFDRFDGDQSRLGDLQVEFVARLARSLDVQLTEAESLRSLRERPVNPDASDLAMR
FT                   GWASLNKQRSIANNNEAIRYFEQALKLDPTLPRATLGLSRALMNKVLNRWSDDIQSDTR
FT                   SADELVNRYLEKFPHDAAALVVKGDVFRADKYFDAAIAMYDAAISDNDDFAAAYAAKGQ
FT                   ASTLSGKAYAAIPNVLQAIRISPRDPLVNVWYYFVCHAHMHMAQWEEAISWCNRSVAVS
FT                   PYWLPYIDLAAAYAWVGHDQEAKAAVSELLKLTPGYTVKKWANAGWSNNPKFLEEYKLI
FT                   VDGLRKAGLQEE"
     MGRTITDRRL VTILVADVVS YSRLIGADET GTLRRLKALR RDVIDPSVTS VHGRIIKTMG        60
     GGFIAEFASA VRAVSCAVTI QQGLARHEAE IPDDRALRLR IGINLGDVVV EPDGDLYGDG       120
     VNVAARLEPL AEPGGICIAR SVYDQVRDNL RYPFQDRGEL ELKNIARPVG VYFLSASAIV       180
     GLAGTDEQAP EPVKTSNRKP WKATAVGAGF LTLLAAGGLG WWSWTASKAP APNQTIAAKL       240
     AGETREAPRL SIVVLPFSNL SNDPEQDYFA DSITEDLTTD LSHLAGSFVI ARNTAFTYKN       300
     KPVGVKQIGQ ELGVRYVLEG SVRRSGERVV VSAELISAET GAQIWFDRFD GDQSRLGDLQ       360
     VEFVARLARS LDVQLTEAES LRSLRERPVN PDASDLAMRG WASLNKQRSI ANNNEAIRYF       420
     EQALKLDPTL PRATLGLSRA LMNKVLNRWS DDIQSDTRSA DELVNRYLEK FPHDAAALVV       480
     KGDVFRADKY FDAAIAMYDA AISDNDDFAA AYAAKGQAST LSGKAYAAIP NVLQAIRISP       540
     RDPLVNVWYY FVCHAHMHMA QWEEAISWCN RSVAVSPYWL PYIDLAAAYA WVGHDQEAKA       600
     AVSELLKLTP GYTVKKWANA GWSNNPKFLE EYKLIVDGLR KAGLQEE                     647
//

If you have problems or comments...

PBIL Back to PBIL home page