(data stored in ACNUC7421 zone)

EMBL: CP001349.PE94

CP001349.PE94        Location/Qualifiers
FT   CDS             103128..103847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55146"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55146.1"
FT                   /translation="MLRRRWSWQSARKLQATVPSLRTGLILRTAPRSCGHRKLRHPPTS
FT                   LLRTDETGASLVRKRQAICRPGGLPSEERSTKGELPDDNRSLDDLVVRSLEHTLGDEIL
FT                   RRGVGPEGDDPAPDHAGAECIQLLHGSRVEVGARPRRCRRIAGNRRCLRRYTGSQRTVT
FT                   LLLRRRKLGRRNLGRLRSCRRGNSRGRSRGSRFCYRSALRRRADRLCRSTQRARINRAD
FT                   GLPVGGGTLLGGQLGNS"
     MLRRRWSWQS ARKLQATVPS LRTGLILRTA PRSCGHRKLR HPPTSLLRTD ETGASLVRKR        60
     QAICRPGGLP SEERSTKGEL PDDNRSLDDL VVRSLEHTLG DEILRRGVGP EGDDPAPDHA       120
     GAECIQLLHG SRVEVGARPR RCRRIAGNRR CLRRYTGSQR TVTLLLRRRK LGRRNLGRLR       180
     SCRRGNSRGR SRGSRFCYRS ALRRRADRLC RSTQRARINR ADGLPVGGGT LLGGQLGNS        239
//

If you have problems or comments...

PBIL Back to PBIL home page