(data stored in ACNUC7421 zone)

EMBL: CP001349.PE95

CP001349.PE95        Location/Qualifiers
FT   CDS             105255..106244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0100"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: met:M446_4738
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55147"
FT                   /db_xref="GOA:B8IUA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55147.1"
FT                   /translation="MDIELVGLTKRYGDTLAVDAISLKIRSGSYCCLLGPSGCGKTTTL
FT                   RMIAGHETVTSGDVVIGPKAVGDLAPARRGTAMMFQSYALFPHLTCRDNVAFGLRMRGM
FT                   PKAERNQRAEAMLRLVQMEALAGRLPAQLSGGQQQRVALARALVTGPKVLLLDEPLSAL
FT                   DPFLRVRMRAELKRIQTELGITFVHVTHSQDEAMALADLVVVMNGGRIEQAADPRTVFE
FT                   RPATAFVARFIGGHNVIALPDHRIAVRADRMLLGPEAGPDAVPARVVAVEYQGSAVHLG
FT                   LEAPDLATDAAAPLLAIVSDRAFAERPLAPGDTVRVGWQAGEAHRLDA"
     MDIELVGLTK RYGDTLAVDA ISLKIRSGSY CCLLGPSGCG KTTTLRMIAG HETVTSGDVV        60
     IGPKAVGDLA PARRGTAMMF QSYALFPHLT CRDNVAFGLR MRGMPKAERN QRAEAMLRLV       120
     QMEALAGRLP AQLSGGQQQR VALARALVTG PKVLLLDEPL SALDPFLRVR MRAELKRIQT       180
     ELGITFVHVT HSQDEAMALA DLVVVMNGGR IEQAADPRTV FERPATAFVA RFIGGHNVIA       240
     LPDHRIAVRA DRMLLGPEAG PDAVPARVVA VEYQGSAVHL GLEAPDLATD AAAPLLAIVS       300
     DRAFAERPLA PGDTVRVGWQ AGEAHRLDA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page