(data stored in ACNUC7421 zone)

EMBL: CP001349.PE96

CP001349.PE96        Location/Qualifiers
FT   CDS             106269..107552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0101"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="KEGG: met:M446_4739 ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55148"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA3"
FT                   /inference="similar to AA sequence:KEGG:M446_4739"
FT                   /protein_id="ACL55148.1"
FT                   /translation="MTDTPNTKGLTRRGLLAGAGAAGVAAGSGAITGFPAVHAAEPVTL
FT                   RYLGTAVNQSGDIARKVKEDLGITIEYIPVVTDEVSKRVVTQPNSFDIVDSEYFSLKKL
FT                   MPSGNLVGMDARRIKYADKITPVFTRGEVAGKKIGDQGTAPRKVFYLEGQNSTKFAASA
FT                   TEWITLIPTTYNADTLGIRPDLIKRPIASWKELLNPEFKGRASILNIPSIGIMDAAMVV
FT                   EAMGEYTYPDKGNMTKAEIDRTMKVLIEAKRAGQFRAFWQDFNESVNLMASGETVIQSM
FT                   WSPAVTKVRSQGVPCIYQPLKEGYRAWASGFGLPKTLSGRKLDAAYDFINWFLSGWAGA
FT                   YLNRQGYYSAVLETARAQMEPYEWAYWMEGKPAEKDIKAPDGTVMEKAGAVRDGGSFEE
FT                   RMGAVACWNSVMDENTYMVRRWNEFIAA"
     MTDTPNTKGL TRRGLLAGAG AAGVAAGSGA ITGFPAVHAA EPVTLRYLGT AVNQSGDIAR        60
     KVKEDLGITI EYIPVVTDEV SKRVVTQPNS FDIVDSEYFS LKKLMPSGNL VGMDARRIKY       120
     ADKITPVFTR GEVAGKKIGD QGTAPRKVFY LEGQNSTKFA ASATEWITLI PTTYNADTLG       180
     IRPDLIKRPI ASWKELLNPE FKGRASILNI PSIGIMDAAM VVEAMGEYTY PDKGNMTKAE       240
     IDRTMKVLIE AKRAGQFRAF WQDFNESVNL MASGETVIQS MWSPAVTKVR SQGVPCIYQP       300
     LKEGYRAWAS GFGLPKTLSG RKLDAAYDFI NWFLSGWAGA YLNRQGYYSA VLETARAQME       360
     PYEWAYWMEG KPAEKDIKAP DGTVMEKAGA VRDGGSFEER MGAVACWNSV MDENTYMVRR       420
     WNEFIAA                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page