(data stored in ACNUC7421 zone)

EMBL: CP001349.PE97

CP001349.PE97        Location/Qualifiers
FT   CDS             107549..108502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_4740
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55149"
FT                   /db_xref="GOA:B8IUA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55149.1"
FT                   /translation="MSPAAERAIRLLGAAAVPRAVPGLAAEGWRQRRLAYLQAAPLALV
FT                   FLVFFVVPLSLTLVVSVWEYNEYEIIPAFTLQNYADIFDGCFSGGDLCTTFRTYLSTLK
FT                   FCLLAWAFTLGIGFTVAYFVAFHVRSSAIQTVLFLLCTIPFWTSNVIRMIAWIPLLGRN
FT                   GLVNDALMSLGLTDRPIEGLLYSDFSVVLAFVHLYTVFMIVPIFNSMMRIDPVLIEAAR
FT                   DAGATGWQTLWSVIVPLSKPGIAIGSIFVLTLAMGDFVTVGVMGGQQIASVGKVIQVQM
FT                   SYLQFPAAAANAVVLLGAVTLVIAGLTRLIDLRREL"
     MSPAAERAIR LLGAAAVPRA VPGLAAEGWR QRRLAYLQAA PLALVFLVFF VVPLSLTLVV        60
     SVWEYNEYEI IPAFTLQNYA DIFDGCFSGG DLCTTFRTYL STLKFCLLAW AFTLGIGFTV       120
     AYFVAFHVRS SAIQTVLFLL CTIPFWTSNV IRMIAWIPLL GRNGLVNDAL MSLGLTDRPI       180
     EGLLYSDFSV VLAFVHLYTV FMIVPIFNSM MRIDPVLIEA ARDAGATGWQ TLWSVIVPLS       240
     KPGIAIGSIF VLTLAMGDFV TVGVMGGQQI ASVGKVIQVQ MSYLQFPAAA ANAVVLLGAV       300
     TLVIAGLTRL IDLRREL                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page