(data stored in ACNUC7421 zone)

EMBL: CP001349.PE98

CP001349.PE98        Location/Qualifiers
FT   CDS             108505..109398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0103"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_4741
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55150"
FT                   /db_xref="GOA:B8IUA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55150.1"
FT                   /translation="MVRDGPRPLAFYLLAGFFALYVLFLYGPTLTILVLSFQGPQGGLT
FT                   FPMNGVSTHWFARLWAGLGVVDIWAAFRRSFALGLVVMALTVTLAFFAGLAFRKGFRGQ
FT                   GLLFHIAVASLIVPSIVVSLGIGLEFRLLDDAVKALAAATGWGFLQDHGTVMGLFTSAL
FT                   GAHLTWTLPFGLLIMFAVFNRFNRAYEEAARDLGASGPRTLLHVVIPIILPSLVGVALF
FT                   GFTLSWDELARTSQAIGGRNTLPLELQGLTTTVTTPEIYALGTVTTGVSLVVIALAFSS
FT                   YLWLQRRRARRALPGG"
     MVRDGPRPLA FYLLAGFFAL YVLFLYGPTL TILVLSFQGP QGGLTFPMNG VSTHWFARLW        60
     AGLGVVDIWA AFRRSFALGL VVMALTVTLA FFAGLAFRKG FRGQGLLFHI AVASLIVPSI       120
     VVSLGIGLEF RLLDDAVKAL AAATGWGFLQ DHGTVMGLFT SALGAHLTWT LPFGLLIMFA       180
     VFNRFNRAYE EAARDLGASG PRTLLHVVIP IILPSLVGVA LFGFTLSWDE LARTSQAIGG       240
     RNTLPLELQG LTTTVTTPEI YALGTVTTGV SLVVIALAFS SYLWLQRRRA RRALPGG          297
//

If you have problems or comments...

PBIL Back to PBIL home page