(data stored in ACNUC7421 zone)

EMBL: CP001349.PE99

CP001349.PE99        Location/Qualifiers
FT   CDS             109724..110560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0104"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   met:M446_1731 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55151"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55151.1"
FT                   /translation="MGIEAGTPRNAAAPSARLAGKVALVFGAGSSGPGWSNGKAVAVTF
FT                   ARAGARVVCIDLDPAAAEETVSIIRHDDGSATAASCDVTNSDAVRAVVEDAVAAHGRID
FT                   ILHNNVGHATMGGPVELDEAAWRRSLDLNLTSCFLTCKHVLPHMLAQRSGSIVNISSVA
FT                   AVRYTGYPYAAYYAAKAAVNHFTVGLALQYAREGIRANAIMPGMMNTPLIFRQIAGQYA
FT                   DADEMVRARDAACPMGRMGTAWDVANAALFLASDEAAYITGVALPVDGGLIARAGS"
     MGIEAGTPRN AAAPSARLAG KVALVFGAGS SGPGWSNGKA VAVTFARAGA RVVCIDLDPA        60
     AAEETVSIIR HDDGSATAAS CDVTNSDAVR AVVEDAVAAH GRIDILHNNV GHATMGGPVE       120
     LDEAAWRRSL DLNLTSCFLT CKHVLPHMLA QRSGSIVNIS SVAAVRYTGY PYAAYYAAKA       180
     AVNHFTVGLA LQYAREGIRA NAIMPGMMNT PLIFRQIAGQ YADADEMVRA RDAACPMGRM       240
     GTAWDVANAA LFLASDEAAY ITGVALPVDG GLIARAGS                               278
//

If you have problems or comments...

PBIL Back to PBIL home page