(data stored in ACNUC7421 zone)

EMBL: CP001389.APAG

CP001389.APAG        Location/Qualifiers
FT   CDS             complement(174671..175063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="NGR_c01540"
FT                   /product="ApaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23956"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFB9"
FT                   /protein_id="ACP23956.1"
FT                   /translation="MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIVISNHSEIAV
FT                   RLMTRYWHITDENGQVDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSME
FT                   AEDGETFNVAIPAFSLDSPGLVRTLN"
     MYRALTRDIE VTVEPYYLEE QSDPDDSRYV WGYRIVISNH SEIAVRLMTR YWHITDENGQ        60
     VDEVSGPGVI GEQPLLNPGD TYEYSSGCPL DTPSGVMFGH YSMEAEDGET FNVAIPAFSL       120
     DSPGLVRTLN                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page