(data stored in ACNUC7421 zone)

EMBL: CP001389.ATPF2

CP001389.ATPF2       Location/Qualifiers
FT   CDS             501842..502453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF2"
FT                   /locus_tag="NGR_c04490"
FT                   /product="FoF1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24245"
FT                   /db_xref="GOA:C3MHB7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB7"
FT                   /protein_id="ACP24245.1"
FT                   /translation="MTAAYAQQSTTTEGAEAHDAPAAGEVHTETGVAHEAEHGSGVFPP
FT                   FDSSHFASQLLWLAITFGLFYLLMSKVIIPRIGGILEKRHDRIAQDLDEASRLKGEADA
FT                   AIASYEQELANARAKGHSIADTAREEAKSKATADRAAVEAELTKKITAAETRIADIKSK
FT                   ALADVGAIAEETATAVVKQLIGGNVTKTEIAAAVKASAGN"
     MTAAYAQQST TTEGAEAHDA PAAGEVHTET GVAHEAEHGS GVFPPFDSSH FASQLLWLAI        60
     TFGLFYLLMS KVIIPRIGGI LEKRHDRIAQ DLDEASRLKG EADAAIASYE QELANARAKG       120
     HSIADTAREE AKSKATADRA AVEAELTKKI TAAETRIADI KSKALADVGA IAEETATAVV       180
     KQLIGGNVTK TEIAAAVKAS AGN                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page