(data stored in ACNUC7421 zone)

EMBL: CP001389.BION

CP001389.BION        Location/Qualifiers
FT   CDS             complement(561922..562527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioN"
FT                   /locus_tag="NGR_c05050"
FT                   /product="putative biotin transporter, permease protein
FT                   BioN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24301"
FT                   /db_xref="GOA:C3MHH3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH3"
FT                   /protein_id="ACP24301.1"
FT                   /translation="MLTSLYVEGQSWFHRVPVRLKLIALLVLSVGLFTTNAPLLLLPAF
FT                   LLCGALYLSLGMTARQAFSRVGFVLFTILILAAVNLFLVPFPDVAALVLRLTALVLFAA
FT                   AVTATTTIGAFMDETTILLKPAERLGLLRAADVSLALGLVLRFVPDIFARYQAISEAHR
FT                   ARGLPIRPLTIIGPLIILTLKDADTIAAAIDARGFRRQ"
     MLTSLYVEGQ SWFHRVPVRL KLIALLVLSV GLFTTNAPLL LLPAFLLCGA LYLSLGMTAR        60
     QAFSRVGFVL FTILILAAVN LFLVPFPDVA ALVLRLTALV LFAAAVTATT TIGAFMDETT       120
     ILLKPAERLG LLRAADVSLA LGLVLRFVPD IFARYQAISE AHRARGLPIR PLTIIGPLII       180
     LTLKDADTIA AAIDARGFRR Q                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page