(data stored in ACNUC7421 zone)

EMBL: CP001389.CHEA2

CP001389.CHEA2       Location/Qualifiers
FT   CDS             295847..298141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA2"
FT                   /locus_tag="NGR_c02540"
FT                   /product="Chemotaxis protein CheA"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24052"
FT                   /db_xref="GOA:C3MG01"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG01"
FT                   /protein_id="ACP24052.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLRLNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLKSADVLADLTNAAR
FT                   DGGSVDEARSRQLIKELEALANGELPQAAVSEPAAKPAPPAAPVPAPAPAPVVNDEGFQ
FT                   PVAFSFDDFEASEPPAIEPSTFEILFRPKSELYAKGNDATLLLRDLSRLGEMSIHCDMD
FT                   ELPALGSMNPEAAYFAWKISLKTDKGEEAIRSVFEFAEWDCELDVALAGGNAGAGEELP
FT                   MQPVPFDLSLLDGDVSASSGAAEDDEQVVAQREARDEAVSAAATASNVLQMAQTARASA
FT                   ESAKSASPASAAQAAAQQAASAATPTIRVDLDRVDRLINLVGELVINQAMLSQSVIEND
FT                   TNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSVRLVT
FT                   EGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGTVRLTAKHRSGRI
FT                   VIELADDGAGINREKVRQKAIDNDLIAADANLSDEEIDNLIFHAGFSTADKISDISGRG
FT                   VGMDVVKRSIQALGGRINISSKPGQGSVFTMSLPLTLAVLDGMVVTVANQTLVVPLTAI
FT                   VETLQPEASAIHSFGASQRLISIRNSFCPLVDVGRILNFRAIQANPVDGVALLVESEGG
FT                   GQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAIVAASRGQT
FT                   LKPEMSLAAAG"
     MDMNEIKEIF FQECEEQLAE LESGLLRLND GDRDPETVNA VFRAVHSIKG GAGAFGLDDL        60
     VSFAHVFETT LDCVRSNRLE PNQDVLKVML KSADVLADLT NAARDGGSVD EARSRQLIKE       120
     LEALANGELP QAAVSEPAAK PAPPAAPVPA PAPAPVVNDE GFQPVAFSFD DFEASEPPAI       180
     EPSTFEILFR PKSELYAKGN DATLLLRDLS RLGEMSIHCD MDELPALGSM NPEAAYFAWK       240
     ISLKTDKGEE AIRSVFEFAE WDCELDVALA GGNAGAGEEL PMQPVPFDLS LLDGDVSASS       300
     GAAEDDEQVV AQREARDEAV SAAATASNVL QMAQTARASA ESAKSASPAS AAQAAAQQAA       360
     SAATPTIRVD LDRVDRLINL VGELVINQAM LSQSVIENDT NGTSSINMGL EELQQLTREI       420
     QDSVMAIRAQ PVKPVFQRMS RIVREIADMT GKSVRLVTEG ENTEVDKTVI DKLAEPLTHM       480
     IRNAVDHGLE TPEKRVAAGK NPEGTVRLTA KHRSGRIVIE LADDGAGINR EKVRQKAIDN       540
     DLIAADANLS DEEIDNLIFH AGFSTADKIS DISGRGVGMD VVKRSIQALG GRINISSKPG       600
     QGSVFTMSLP LTLAVLDGMV VTVANQTLVV PLTAIVETLQ PEASAIHSFG ASQRLISIRN       660
     SFCPLVDVGR ILNFRAIQAN PVDGVALLVE SEGGGQRALM VDAIQGQRQV VIKSLEANYT       720
     HVPGIAAATI LGDGRVALIL DVDAIVAASR GQTLKPEMSL AAAG                        764
//

If you have problems or comments...

PBIL Back to PBIL home page