(data stored in ACNUC7421 zone)

EMBL: CP001389.CHEB2

CP001389.CHEB2       Location/Qualifiers
FT   CDS             299515..300567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB2"
FT                   /locus_tag="NGR_c02570"
FT                   /product="Chemotaxis response regulator protein-glutamate
FT                   methylesterase CheB"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24055"
FT                   /db_xref="GOA:C3MG04"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG04"
FT                   /protein_id="ACP24055.1"
FT                   /translation="MNAPARVLVVDDSPTMRGLISAVLNADPEVKVVGQAADALEARQA
FT                   IKQLDPDVVTLDIEMPNMNGLEFLDKIMRLRPMPVIMVSTLTHKGAEATIAALEIGAFD
FT                   CVGKPHPGDPNPFGGLVDKVKAAARSQRKSMITSNRAASAPAVATASDYRAGRKIIAIG
FT                   ASTGGVEALIAVLQKFPANCPPTVITQHMPHTFTKSFSERLNRLCAPTVEEATDGARLE
FT                   VGKVYLAPGGDRHLQIANASAPCCRLVDREPVNGHRPSVDVLFDSVAELAGRNAIGVIL
FT                   TGMGRDGAAGLLKMRHAGARTFGQNEKTCVVYGMPRVAHELGAVEMQLPLGSIGEEILK
FT                   SAAARKEGNE"
     MNAPARVLVV DDSPTMRGLI SAVLNADPEV KVVGQAADAL EARQAIKQLD PDVVTLDIEM        60
     PNMNGLEFLD KIMRLRPMPV IMVSTLTHKG AEATIAALEI GAFDCVGKPH PGDPNPFGGL       120
     VDKVKAAARS QRKSMITSNR AASAPAVATA SDYRAGRKII AIGASTGGVE ALIAVLQKFP       180
     ANCPPTVITQ HMPHTFTKSF SERLNRLCAP TVEEATDGAR LEVGKVYLAP GGDRHLQIAN       240
     ASAPCCRLVD REPVNGHRPS VDVLFDSVAE LAGRNAIGVI LTGMGRDGAA GLLKMRHAGA       300
     RTFGQNEKTC VVYGMPRVAH ELGAVEMQLP LGSIGEEILK SAAARKEGNE                  350
//

If you have problems or comments...

PBIL Back to PBIL home page