(data stored in ACNUC7421 zone)

EMBL: CP001389.CHED

CP001389.CHED        Location/Qualifiers
FT   CDS             300953..301507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="NGR_c02590"
FT                   /product="predicted chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24057"
FT                   /db_xref="GOA:C3MG06"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG06"
FT                   /protein_id="ACP24057.1"
FT                   /translation="MMLEAAGRRVHVIQGEFKVVNDPDVVLSTILGSCVAACMRDPVSG
FT                   VGGMNHFLLPGSSTSPASAGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIA
FT                   RFSNVGEQNAAFARQFLLDEGIRVVGESTGGEHGRKLEYWPVTGRARQYALTGVEAQRA
FT                   IHQDQRPAPAPKPVESSIEFF"
     MMLEAAGRRV HVIQGEFKVV NDPDVVLSTI LGSCVAACMR DPVSGVGGMN HFLLPGSSTS        60
     PASAGDATRY GVHLMELLIN GLLKQGARRD RLEAKIFGGA KTIARFSNVG EQNAAFARQF       120
     LLDEGIRVVG ESTGGEHGRK LEYWPVTGRA RQYALTGVEA QRAIHQDQRP APAPKPVESS       180
     IEFF                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page