(data stored in ACNUC7421 zone)

EMBL: CP001389.CHER

CP001389.CHER        Location/Qualifiers
FT   CDS             298610..299518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="NGR_c02560"
FT                   /product="Chemotaxis protein methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24054"
FT                   /db_xref="GOA:C3MG03"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG03"
FT                   /protein_id="ACP24054.1"
FT                   /translation="MRAQATFEQKLSPDECLAAGEYPLTRRDLGEIAAMIYADAGIYLN
FT                   ESKASLVYSRLSKHIRNLGLKGFRDYCQLVASPAGAAARRDMLSHLTTNFTRFFRENHH
FT                   FEHLKTDVLPGLIARAKNGGRVRIWSAACSDGQEPYSIALTVLSLLPNAADYDFRILAT
FT                   DIDPKILALARAGAYDATALETVSPAMRKQWFREVDVNGRGKWQVDDRVKRLITFNELN
FT                   LMAQWPLKGPFDVIFCRNVVIYFDEPTQMKIWSRFAGVLDTGGHLYIGHSERVSGDAKA
FT                   IFDNIGVTTYRHTGKFHGGRA"
     MRAQATFEQK LSPDECLAAG EYPLTRRDLG EIAAMIYADA GIYLNESKAS LVYSRLSKHI        60
     RNLGLKGFRD YCQLVASPAG AAARRDMLSH LTTNFTRFFR ENHHFEHLKT DVLPGLIARA       120
     KNGGRVRIWS AACSDGQEPY SIALTVLSLL PNAADYDFRI LATDIDPKIL ALARAGAYDA       180
     TALETVSPAM RKQWFREVDV NGRGKWQVDD RVKRLITFNE LNLMAQWPLK GPFDVIFCRN       240
     VVIYFDEPTQ MKIWSRFAGV LDTGGHLYIG HSERVSGDAK AIFDNIGVTT YRHTGKFHGG       300
     RA                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page