(data stored in ACNUC7421 zone)

EMBL: CP001389.CHEW1

CP001389.CHEW1       Location/Qualifiers
FT   CDS             298146..298613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="NGR_c02550"
FT                   /product="putative CheW family chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24053"
FT                   /db_xref="GOA:C3MG02"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG02"
FT                   /protein_id="ACP24053.1"
FT                   /translation="MTYVAKNLTTGGRELIAFRVGGQEFCVNIMSVREIRGWTPAIAMP
FT                   HAPSYMLGIVNLRGAVLPIIDFSARLGMKAAEPTVRHVIIVAQVKSQVVGLLVDAVSDI
FT                   LTVSDGDIQPTPDIASDFERSFARGVLAIEGRMICLVELDQVFPHEEREAA"
     MTYVAKNLTT GGRELIAFRV GGQEFCVNIM SVREIRGWTP AIAMPHAPSY MLGIVNLRGA        60
     VLPIIDFSAR LGMKAAEPTV RHVIIVAQVK SQVVGLLVDA VSDILTVSDG DIQPTPDIAS       120
     DFERSFARGV LAIEGRMICL VELDQVFPHE EREAA                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page