(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAC

CP001389.CTAC        Location/Qualifiers
FT   CDS             579704..580588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="NGR_c05230"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24319"
FT                   /db_xref="GOA:C3MHJ1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ1"
FT                   /protein_id="ACP24319.1"
FT                   /translation="MKNKAYAVLAALACLLFASSAFADKPVDWQTRFQAAATGIMEEIT
FT                   WFEQYTLWFIIPITLLVLLLLIIVVVKFREGANPVPSRTSHNTAIEVIWTVGPVIILLF
FT                   LAIPSFKLLNAQLTPPQNPDLTVKATGNQWYWSYEYEVGENPLSFDSLLLKDEDRASAG
FT                   KEDKAAYPRLLAVDNEVVVPVGKTVRLLVTAADVIHAFAMPAFGVKIDAVPGRLNETWF
FT                   KAAREGLYYGQCSELCGKDHAYMPIAVRVVSQEKYDAWLAAAATNLGEANKALMASIDG
FT                   AAKTVDVAANAAQ"
     MKNKAYAVLA ALACLLFASS AFADKPVDWQ TRFQAAATGI MEEITWFEQY TLWFIIPITL        60
     LVLLLLIIVV VKFREGANPV PSRTSHNTAI EVIWTVGPVI ILLFLAIPSF KLLNAQLTPP       120
     QNPDLTVKAT GNQWYWSYEY EVGENPLSFD SLLLKDEDRA SAGKEDKAAY PRLLAVDNEV       180
     VVPVGKTVRL LVTAADVIHA FAMPAFGVKI DAVPGRLNET WFKAAREGLY YGQCSELCGK       240
     DHAYMPIAVR VVSQEKYDAW LAAAATNLGE ANKALMASID GAAKTVDVAA NAAQ             294
//

If you have problems or comments...

PBIL Back to PBIL home page