(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAD

CP001389.CTAD        Location/Qualifiers
FT   CDS             580609..582300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="NGR_c05240"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24320"
FT                   /db_xref="GOA:C3MHJ2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ2"
FT                   /protein_id="ACP24320.1"
FT                   /translation="MAGTAVHHDHRHDHSDHAHDADHAHKPLTFFQRWFLSTNHKDIGT
FT                   LYLIFGIIAGLIGGTLSVFMRAELQEPGIQIFHGLAQMVYGFEGDAAIDGGKHMFNVFT
FT                   TAHALIMIFFMVMPALIGGFANWMVPIMIGAPDMAFPRMNNISFWLIVPAFLLVLLSMF
FT                   VEGPAGAYGAGGGWTIYPPFSTSGMPGPAMDLAILGLHIAGASSILGAINFITTILNMR
FT                   APGMTLHKMPLFAWSVLITAFLLLLSLPVLAGAITMLLTDRNFGTTFFAPEGGGDPILF
FT                   QHLFWFFGHPEVYILILPGFGIVSHIISTFSRKPIFGYLGMAYAMVAIGAVGFIVWAHH
FT                   MYTVGMSLETQRYFVFATMVIAVPTGVKIFSWIATMWGGSIRFTTPMVWAIGFIFLFTV
FT                   GGVTGVQLANAGLDRALHDTYYVVAHFHYVLSLGAVFAIFAAWYYWFPKMSGYMYSEFL
FT                   GKLHFWVMFVGVNLIFFPQHFLGLAGMPRRYIDYPDAFAGWNMVSSYGSYIAAVGVLIF
FT                   LFGVAEAFAKKRVAGDNPWGEGANTLEWQLSSPPPFHQWEQLPRIK"
     MAGTAVHHDH RHDHSDHAHD ADHAHKPLTF FQRWFLSTNH KDIGTLYLIF GIIAGLIGGT        60
     LSVFMRAELQ EPGIQIFHGL AQMVYGFEGD AAIDGGKHMF NVFTTAHALI MIFFMVMPAL       120
     IGGFANWMVP IMIGAPDMAF PRMNNISFWL IVPAFLLVLL SMFVEGPAGA YGAGGGWTIY       180
     PPFSTSGMPG PAMDLAILGL HIAGASSILG AINFITTILN MRAPGMTLHK MPLFAWSVLI       240
     TAFLLLLSLP VLAGAITMLL TDRNFGTTFF APEGGGDPIL FQHLFWFFGH PEVYILILPG       300
     FGIVSHIIST FSRKPIFGYL GMAYAMVAIG AVGFIVWAHH MYTVGMSLET QRYFVFATMV       360
     IAVPTGVKIF SWIATMWGGS IRFTTPMVWA IGFIFLFTVG GVTGVQLANA GLDRALHDTY       420
     YVVAHFHYVL SLGAVFAIFA AWYYWFPKMS GYMYSEFLGK LHFWVMFVGV NLIFFPQHFL       480
     GLAGMPRRYI DYPDAFAGWN MVSSYGSYIA AVGVLIFLFG VAEAFAKKRV AGDNPWGEGA       540
     NTLEWQLSSP PPFHQWEQLP RIK                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page