(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAE

CP001389.CTAE        Location/Qualifiers
FT   CDS             584171..585049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="NGR_c05280"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24324"
FT                   /db_xref="GOA:C3MHJ6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ6"
FT                   /protein_id="ACP24324.1"
FT                   /translation="MAGAHQKNHDYHIIDPSPWPLLASIGAFVMAFGGVGLMRYVAGGS
FT                   FKLFGLELANPWLFLIGLAIVLYTMFGWWSDTIKEGREGHHTRVVSLHLRYGMIMFIAS
FT                   EVMFFAAWFWAFFDASLFAGEPIQAARAAYTGGVWPPKGIEVLDPWHLPLYNTVILLLS
FT                   GTTVTWAHHALLHNDRKGLISGLTLTVLLGVLFSFVQGYEYAHAPFAFRDSIYGATFFM
FT                   ATGFHGFHVLVGTIFLLVCLFRALGGGFSQQHHFGFEAAAWYWHFVDVVWLFLFFSIYI
FT                   WGGWGAPIAHG"
     MAGAHQKNHD YHIIDPSPWP LLASIGAFVM AFGGVGLMRY VAGGSFKLFG LELANPWLFL        60
     IGLAIVLYTM FGWWSDTIKE GREGHHTRVV SLHLRYGMIM FIASEVMFFA AWFWAFFDAS       120
     LFAGEPIQAA RAAYTGGVWP PKGIEVLDPW HLPLYNTVIL LLSGTTVTWA HHALLHNDRK       180
     GLISGLTLTV LLGVLFSFVQ GYEYAHAPFA FRDSIYGATF FMATGFHGFH VLVGTIFLLV       240
     CLFRALGGGF SQQHHFGFEA AAWYWHFVDV VWLFLFFSIY IWGGWGAPIA HG               292
//

If you have problems or comments...

PBIL Back to PBIL home page