(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAG

CP001389.CTAG        Location/Qualifiers
FT   CDS             583509..584108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="NGR_c05270"
FT                   /product="cytochrome c oxidase assembly protein CtaG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24323"
FT                   /db_xref="GOA:C3MHJ5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHJ5"
FT                   /protein_id="ACP24323.1"
FT                   /translation="MTNTPQTPPKERANGVIVGACLAFVAGMVGMAYAAVPLYDMFCRV
FT                   TGYNGTTQRVEQASDVILDEKIKVTFDANVGPGLAWDFKPVQRDIDVRIGETVQVMYRA
FT                   KNLSSKPATGQATFNVTPMAAGAYFNKVQCFCFTETTLQPGEEMEMPVVFFVDPEIVKP
FT                   VETKDIKTLTLSYTFYPREPSKPIAAVKDGETENRL"
     MTNTPQTPPK ERANGVIVGA CLAFVAGMVG MAYAAVPLYD MFCRVTGYNG TTQRVEQASD        60
     VILDEKIKVT FDANVGPGLA WDFKPVQRDI DVRIGETVQV MYRAKNLSSK PATGQATFNV       120
     TPMAAGAYFN KVQCFCFTET TLQPGEEMEM PVVFFVDPEI VKPVETKDIK TLTLSYTFYP       180
     REPSKPIAAV KDGETENRL                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page