(data stored in ACNUC7421 zone)

EMBL: CP001389.DCD

CP001389.DCD         Location/Qualifiers
FT   CDS             177225..178322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="NGR_c01580"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase
FT                   protein"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23959"
FT                   /db_xref="GOA:C3MFC2"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC2"
FT                   /protein_id="ACP23959.1"
FT                   /translation="MGRETGILADRAIAALFASGRLKSEKALDDDQIQPASLDLRLGSK
FT                   AFRVRASFMPGPAHLVADKLDRLKLHVIDLSAGAVLETGCVYIVPLMESLSLPEGMSAS
FT                   ANPKSSTGRLDIFTRVITDRAQEFDKIPAGYNGPLYLEISPRTFPIVVRRGSRLSQIRF
FT                   RVGHSVLSEQELLGLHESDVLVASERPNISGGGIALSIDLKGTGPDGLIGYRGKHHTSV
FT                   VDVDKKAEHAVFDFWEPLYSRGRDDLILDPDEFYILVSREAVHVPPLYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHASAGGSGSRAVLEVRSHEVPFILEHGQIVGRLIYEHMLERPE
FT                   GLYGLDLGSNYQAQGLKLSKHFRAE"
     MGRETGILAD RAIAALFASG RLKSEKALDD DQIQPASLDL RLGSKAFRVR ASFMPGPAHL        60
     VADKLDRLKL HVIDLSAGAV LETGCVYIVP LMESLSLPEG MSASANPKSS TGRLDIFTRV       120
     ITDRAQEFDK IPAGYNGPLY LEISPRTFPI VVRRGSRLSQ IRFRVGHSVL SEQELLGLHE       180
     SDVLVASERP NISGGGIALS IDLKGTGPDG LIGYRGKHHT SVVDVDKKAE HAVFDFWEPL       240
     YSRGRDDLIL DPDEFYILVS REAVHVPPLY AAEMTPFDPL VGEFRVHYAG FFDPGFGHAS       300
     AGGSGSRAVL EVRSHEVPFI LEHGQIVGRL IYEHMLERPE GLYGLDLGSN YQAQGLKLSK       360
     HFRAE                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page