(data stored in ACNUC7421 zone)

EMBL: CP001389.DINF

CP001389.DINF        Location/Qualifiers
FT   CDS             202247..203614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="NGR_c01800"
FT                   /product="DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23980"
FT                   /db_xref="GOA:C3MFS9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS9"
FT                   /protein_id="ACP23980.1"
FT                   /translation="MTAMAGRERERLASEAGPFDVTNRLILSIALPMTLGFLTTPLLGL
FT                   VDTGVVGRLGRAEMLAGLAIGAVLFDLIFTTFNFLRASTTGLVAQAYGRGDRREQQAVF
FT                   WRSLVIALFCGVAIVLLSPLLLSLGLWLMAPEAEVAAVTRTYFLYRMLSGPAALANYAI
FT                   LGFVLGRGEGTLGLLLQTLINGINIVLAILLGLVLGWGVAGVAIATVTGEVAGAVAGFA
FT                   IVYSRFDRRDAPNWATIFAGDRLKALFGLNRDIMIRSFVLLAAFTLMTRIGSSLGPVTL
FT                   AANAVLMTIFLVAGYYLDGLANAAEQLTGRSIGAAYRPGFDRALRMTALWSLGLALLTT
FT                   VFFLAFGNGLVDLLTTAPEVRALAYEFMPWAAVTALTGAMAFLMDGVFIGATWSRDMRN
FT                   MMLAAFVVYGAALTVLVPAFGNHGLWAGLNLFLLLRGLFLVLLLPRRAAQTFRPAQ"
     MTAMAGRERE RLASEAGPFD VTNRLILSIA LPMTLGFLTT PLLGLVDTGV VGRLGRAEML        60
     AGLAIGAVLF DLIFTTFNFL RASTTGLVAQ AYGRGDRREQ QAVFWRSLVI ALFCGVAIVL       120
     LSPLLLSLGL WLMAPEAEVA AVTRTYFLYR MLSGPAALAN YAILGFVLGR GEGTLGLLLQ       180
     TLINGINIVL AILLGLVLGW GVAGVAIATV TGEVAGAVAG FAIVYSRFDR RDAPNWATIF       240
     AGDRLKALFG LNRDIMIRSF VLLAAFTLMT RIGSSLGPVT LAANAVLMTI FLVAGYYLDG       300
     LANAAEQLTG RSIGAAYRPG FDRALRMTAL WSLGLALLTT VFFLAFGNGL VDLLTTAPEV       360
     RALAYEFMPW AAVTALTGAM AFLMDGVFIG ATWSRDMRNM MLAAFVVYGA ALTVLVPAFG       420
     NHGLWAGLNL FLLLRGLFLV LLLPRRAAQT FRPAQ                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page