(data stored in ACNUC7421 zone)

EMBL: CP001389.DNAA

CP001389.DNAA        Location/Qualifiers
FT   CDS             202..1644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="NGR_c00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23805"
FT                   /db_xref="GOA:C3MEI2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI2"
FT                   /protein_id="ACP23805.1"
FT                   /translation="MRHDALFERVSARLKAQVGPDVFASWFGRLKLHSVSKSVVRLSVP
FT                   TTFLKSWINNRYLELITSLFQQEDGEILKVEILVRTATRGQRPAVHEEAVAAAAEPAAA
FT                   APVRRAASPQPVAAAAATVAASAKPVQAPLFGSPLDQRYNFESFVEGSSNRVALAAART
FT                   IAEAGAGAVRFNPLFIHSSVGLGKTHLLQAIALAALQSARAPRVVYLTAEYFMWRFATA
FT                   IRDNDALSLKESLRNIDLLVIDDMQFLQGKSIQHEFCHLLNMLLDSAKQVVVAADRAPW
FT                   ELESLDSRVRSRLQGGVAIEMEGPDYDMRLEMLKRRLDTARQDDTSLDIPQEILSHVAR
FT                   SVTASGRELEGAFNQLLFRRSFEPQLSIERVDELLGHLVNAGEPRRVRIEDIQRIVAKH
FT                   YNVSRQELVSNRRTRVIVKPRQIAMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIE
FT                   ELISGDTKLSHEIELLKRLINE"
     MRHDALFERV SARLKAQVGP DVFASWFGRL KLHSVSKSVV RLSVPTTFLK SWINNRYLEL        60
     ITSLFQQEDG EILKVEILVR TATRGQRPAV HEEAVAAAAE PAAAAPVRRA ASPQPVAAAA       120
     ATVAASAKPV QAPLFGSPLD QRYNFESFVE GSSNRVALAA ARTIAEAGAG AVRFNPLFIH       180
     SSVGLGKTHL LQAIALAALQ SARAPRVVYL TAEYFMWRFA TAIRDNDALS LKESLRNIDL       240
     LVIDDMQFLQ GKSIQHEFCH LLNMLLDSAK QVVVAADRAP WELESLDSRV RSRLQGGVAI       300
     EMEGPDYDMR LEMLKRRLDT ARQDDTSLDI PQEILSHVAR SVTASGRELE GAFNQLLFRR       360
     SFEPQLSIER VDELLGHLVN AGEPRRVRIE DIQRIVAKHY NVSRQELVSN RRTRVIVKPR       420
     QIAMYLSKTL TPRSFPEIGR RFGGRDHTTV LHAVRKIEEL ISGDTKLSHE IELLKRLINE       480
//

If you have problems or comments...

PBIL Back to PBIL home page