(data stored in ACNUC7421 zone)

EMBL: CP001389.DNAJ3

CP001389.DNAJ3       Location/Qualifiers
FT   CDS             572856..573908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ3"
FT                   /locus_tag="NGR_c05160"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24312"
FT                   /db_xref="GOA:C3MHI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI4"
FT                   /protein_id="ACP24312.1"
FT                   /translation="MRDPYAILGVRRSAGQEEIKTAWRSVAKAIHPDHNQDDPLATERF
FT                   AEAGRAYELLRDPARRNRYDQARREAELRRMEAMKEKMRGPEPAEEPVGTESAEEAISR
FT                   IFGVDPQPAPSAGRPKASASRPAEKTGAAAEAKPDTPAETKHEPASTEATVRRLAAPGT
FT                   ELVAAIVRRIRDRITKTAEKVPDLVVDLSVSIDEVIDRARVSLELPDGETVKVAIPPGA
FT                   TDGQVVRLREQGYRVAGMTRGDVVATLRICQDGPFRTRGLDLVTTLPLDLQDAVLGCET
FT                   TIETPNGTATVEVPAWSGSDKVIRIPGKGLNGAYGQYGDLLVELRLVLHEKPDDKVTDL
FT                   MRSQRDGLYL"
     MRDPYAILGV RRSAGQEEIK TAWRSVAKAI HPDHNQDDPL ATERFAEAGR AYELLRDPAR        60
     RNRYDQARRE AELRRMEAMK EKMRGPEPAE EPVGTESAEE AISRIFGVDP QPAPSAGRPK       120
     ASASRPAEKT GAAAEAKPDT PAETKHEPAS TEATVRRLAA PGTELVAAIV RRIRDRITKT       180
     AEKVPDLVVD LSVSIDEVID RARVSLELPD GETVKVAIPP GATDGQVVRL REQGYRVAGM       240
     TRGDVVATLR ICQDGPFRTR GLDLVTTLPL DLQDAVLGCE TTIETPNGTA TVEVPAWSGS       300
     DKVIRIPGKG LNGAYGQYGD LLVELRLVLH EKPDDKVTDL MRSQRDGLYL                  350
//

If you have problems or comments...

PBIL Back to PBIL home page