(data stored in ACNUC7421 zone)

EMBL: CP001389.DPPA

CP001389.DPPA        Location/Qualifiers
FT   CDS             393363..394958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="NGR_c03460"
FT                   /product="periplasmic dipeptide ABC transport protein
FT                   precursor DppA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24143"
FT                   /db_xref="GOA:C3MGM8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM8"
FT                   /protein_id="ACP24143.1"
FT                   /translation="MKKLTTLFAATALATLMAGTAWSKTFVYCSEGSPEGFDPGLYTAG
FT                   TTFDAAAHTVYSRLLEFKKGTTETEPGLAESWTISDDGLEYTFKLRPGVKFQTTEFFTP
FT                   TRELNADDVIFSLERQWKSDNAWHGYVTGGSWEYFAGMGLPELLESIEKVDDMTVKIKL
FT                   KRKEAPFLANLAMPFASIMSKEYADKLQAEGKMNQLNQMPLGTGPFAFVGYQQDAVIRY
FT                   KAHPDYWGGKQKIDDLVFSITTDAAVRFQKLQAGECHLMPYPNAADVEAMKADPNLKVM
FT                   EQAGLNVAYLAYNTTQAPFDKPEVRKALNKAINKQAIVDAVFQGQATPATNPIPPTMWS
FT                   YDDTVADDTYEPEVAKKMLEDAGVKDLSMKVWAMPVARPYMLNARRAAELMQADFAKVG
FT                   VKVEIVSYEWAEYLEKSKDKARDGAVILGWTGDNGDPDNFLDTLLGCDAVGGNNRAQWC
FT                   NKEFDDLVTKAKEASDVAERTKLYQQAQAVFKKEAPWATLDHSLSIVPMRKNVEGFVQS
FT                   PLGDFAFDGVDIVE"
     MKKLTTLFAA TALATLMAGT AWSKTFVYCS EGSPEGFDPG LYTAGTTFDA AAHTVYSRLL        60
     EFKKGTTETE PGLAESWTIS DDGLEYTFKL RPGVKFQTTE FFTPTRELNA DDVIFSLERQ       120
     WKSDNAWHGY VTGGSWEYFA GMGLPELLES IEKVDDMTVK IKLKRKEAPF LANLAMPFAS       180
     IMSKEYADKL QAEGKMNQLN QMPLGTGPFA FVGYQQDAVI RYKAHPDYWG GKQKIDDLVF       240
     SITTDAAVRF QKLQAGECHL MPYPNAADVE AMKADPNLKV MEQAGLNVAY LAYNTTQAPF       300
     DKPEVRKALN KAINKQAIVD AVFQGQATPA TNPIPPTMWS YDDTVADDTY EPEVAKKMLE       360
     DAGVKDLSMK VWAMPVARPY MLNARRAAEL MQADFAKVGV KVEIVSYEWA EYLEKSKDKA       420
     RDGAVILGWT GDNGDPDNFL DTLLGCDAVG GNNRAQWCNK EFDDLVTKAK EASDVAERTK       480
     LYQQAQAVFK KEAPWATLDH SLSIVPMRKN VEGFVQSPLG DFAFDGVDIV E                531
//

If you have problems or comments...

PBIL Back to PBIL home page