(data stored in ACNUC7421 zone)

EMBL: CP001389.DPPC

CP001389.DPPC        Location/Qualifiers
FT   CDS             396083..396991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="NGR_c03480"
FT                   /product="dipeptide ABC transport system permease protein
FT                   DppC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24145"
FT                   /db_xref="GOA:C3MGN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN0"
FT                   /protein_id="ACP24145.1"
FT                   /translation="MTEVTATSPISTDPSRRARLAEFWYYFSENRGAVIGLFFFLFLVV
FT                   LALCAPLVAPHDPTVQFREAVLLPPFWQEGGRLEFLLGTDAVGRDMLSRLIYGTRFSLF
FT                   VGVIVTTLSLVGGILVGVVAGYFRGWVDTFIMRIMDIILAFPSLLLALVLVAVLGPGLT
FT                   NAMIAIALVFQPHFVRLTRAAVMTEKTRDYVVAAKVAGAGHLRLMFRTILPNCMAPLIV
FT                   QATLSFSSAILDAAALGFLGMGAQPPTPEWGTMLAEAREFILRAWWVVTLPGLAILLTV
FT                   LAINLMGDGLRDALDPKLKRS"
     MTEVTATSPI STDPSRRARL AEFWYYFSEN RGAVIGLFFF LFLVVLALCA PLVAPHDPTV        60
     QFREAVLLPP FWQEGGRLEF LLGTDAVGRD MLSRLIYGTR FSLFVGVIVT TLSLVGGILV       120
     GVVAGYFRGW VDTFIMRIMD IILAFPSLLL ALVLVAVLGP GLTNAMIAIA LVFQPHFVRL       180
     TRAAVMTEKT RDYVVAAKVA GAGHLRLMFR TILPNCMAPL IVQATLSFSS AILDAAALGF       240
     LGMGAQPPTP EWGTMLAEAR EFILRAWWVV TLPGLAILLT VLAINLMGDG LRDALDPKLK       300
     RS                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page