(data stored in ACNUC7421 zone)

EMBL: CP001389.DPPD

CP001389.DPPD        Location/Qualifiers
FT   CDS             396993..397847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="NGR_c03490"
FT                   /product="dipeptide ABC transporter ATP-binding protein
FT                   DppD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24146"
FT                   /db_xref="GOA:C3MGN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN1"
FT                   /protein_id="ACP24146.1"
FT                   /translation="MALLEIENLVVEFQTATGPFRAVDGVSLKVHEGEVLAIVGESGSG
FT                   KSVSMLAAMGLLPWTAKVTADKLAFNGRDLLKMPAAERRKIVGKDIAMIFQEPIASLNP
FT                   CFTVGFQIEEVLRIHMGLNRAARRRRAIELFQAVGIPDPAERLGHYPHQMSGGQCQRVM
FT                   IAIALACNPKLLIADEPTTALDVTIQKQILDLLMKLQQEYRMGLIMITHNMGVVAETAD
FT                   RVVVQYKGRKIEEADVLSLFEAPKSNYTRALLAALPENATGDRLPTISELFNEQQTLEG
FT                   AAR"
     MALLEIENLV VEFQTATGPF RAVDGVSLKV HEGEVLAIVG ESGSGKSVSM LAAMGLLPWT        60
     AKVTADKLAF NGRDLLKMPA AERRKIVGKD IAMIFQEPIA SLNPCFTVGF QIEEVLRIHM       120
     GLNRAARRRR AIELFQAVGI PDPAERLGHY PHQMSGGQCQ RVMIAIALAC NPKLLIADEP       180
     TTALDVTIQK QILDLLMKLQ QEYRMGLIMI THNMGVVAET ADRVVVQYKG RKIEEADVLS       240
     LFEAPKSNYT RALLAALPEN ATGDRLPTIS ELFNEQQTLE GAAR                        284
//

If you have problems or comments...

PBIL Back to PBIL home page