(data stored in ACNUC7421 zone)

EMBL: CP001389.DPPF

CP001389.DPPF        Location/Qualifiers
FT   CDS             397844..398671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="NGR_c03500"
FT                   /product="dipeptide ABC transporter ATP-binding protein
FT                   DppF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24147"
FT                   /db_xref="GOA:C3MGN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN2"
FT                   /protein_id="ACP24147.1"
FT                   /translation="MTHVLEARNLVRDYHIPGSLFRKARTVHALKGVSFAVDEGKTLAI
FT                   VGESGCGKSTLGRIITLIDPATAGELLIDGKKVDIARDGLTSEMRRKVQIVFQNPYGSL
FT                   NPRQKIGDILAEPLVINTKVPAGERRDRAMTMLKKVGLEEKHYNRYPHMFSGGQRQRIA
FT                   IARALMLNPKLLVLDEPVSALDLSVQAQVLNLLADLQDEFKLTYVFISHDLSVVRYIAD
FT                   DVMVMYYGEAVEYGSRDEVFSNPQHSYTKTLFAATPRADVASIKARLARRNAA"
     MTHVLEARNL VRDYHIPGSL FRKARTVHAL KGVSFAVDEG KTLAIVGESG CGKSTLGRII        60
     TLIDPATAGE LLIDGKKVDI ARDGLTSEMR RKVQIVFQNP YGSLNPRQKI GDILAEPLVI       120
     NTKVPAGERR DRAMTMLKKV GLEEKHYNRY PHMFSGGQRQ RIAIARALML NPKLLVLDEP       180
     VSALDLSVQA QVLNLLADLQ DEFKLTYVFI SHDLSVVRYI ADDVMVMYYG EAVEYGSRDE       240
     VFSNPQHSYT KTLFAATPRA DVASIKARLA RRNAA                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page