(data stored in ACNUC7421 zone)

EMBL: CP001389.FABG2

CP001389.FABG2       Location/Qualifiers
FT   CDS             complement(696355..697146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG2"
FT                   /locus_tag="NGR_c06410"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="3-ketoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24434"
FT                   /db_xref="GOA:C3MI86"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI86"
FT                   /protein_id="ACP24434.1"
FT                   /translation="MRLNGKTAIVTGAARGIGRAIAVAFAREGAQVVVCDRDEEAAKLT
FT                   AEEIGSAALAVRADISVDEDVSGLVDQALARFGKIDILVNNAGIGATTLFLESSREEFE
FT                   RVVRINLTGTFLVSQAVARTMAEHKSGSIVNIASLSGQKGGVGRSAYGASKAGVELLNK
FT                   VMAVELADHGINVNAIAPGPILTEVSRTMHTIETREAYHRLVPQRRYGEPEEIADAAVF
FT                   LASEEARYITGHTLNVDGGFLAAGLLFPFDPKTSKKLGDER"
     MRLNGKTAIV TGAARGIGRA IAVAFAREGA QVVVCDRDEE AAKLTAEEIG SAALAVRADI        60
     SVDEDVSGLV DQALARFGKI DILVNNAGIG ATTLFLESSR EEFERVVRIN LTGTFLVSQA       120
     VARTMAEHKS GSIVNIASLS GQKGGVGRSA YGASKAGVEL LNKVMAVELA DHGINVNAIA       180
     PGPILTEVSR TMHTIETREA YHRLVPQRRY GEPEEIADAA VFLASEEARY ITGHTLNVDG       240
     GFLAAGLLFP FDPKTSKKLG DER                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page