(data stored in ACNUC7421 zone)

EMBL: CP001389.FABG3

CP001389.FABG3       Location/Qualifiers
FT   CDS             661130..661885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG3"
FT                   /locus_tag="NGR_c06050"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="3-ketoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24398"
FT                   /db_xref="GOA:C3MI50"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI50"
FT                   /protein_id="ACP24398.1"
FT                   /translation="MQTNLNGKVALVTGGGRDVGGDIARSLAAEGAIVAVNYSRSQAEA
FT                   DSVVASIEAAGGKAKAYKADIGENDQVKAMIAAVKADFGTIDVLVNNAGYVKYQRFVDS
FT                   TPEEWKKQIDVCLYGAINCCHAVAPLMIEQNFGRIINLVGDSSRIGEANLALAAAARGG
FT                   TIALGKSLAREFGRNNITVNSVSLGLIETSHSDPEFLEKNREKIVKAYPLRRIGRPDDV
FT                   APMVTFLASEGSSWVTGQVISVNGGFCMV"
     MQTNLNGKVA LVTGGGRDVG GDIARSLAAE GAIVAVNYSR SQAEADSVVA SIEAAGGKAK        60
     AYKADIGEND QVKAMIAAVK ADFGTIDVLV NNAGYVKYQR FVDSTPEEWK KQIDVCLYGA       120
     INCCHAVAPL MIEQNFGRII NLVGDSSRIG EANLALAAAA RGGTIALGKS LAREFGRNNI       180
     TVNSVSLGLI ETSHSDPEFL EKNREKIVKA YPLRRIGRPD DVAPMVTFLA SEGSSWVTGQ       240
     VISVNGGFCM V                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page