(data stored in ACNUC7421 zone)

EMBL: CP001389.FABI3

CP001389.FABI3       Location/Qualifiers
FT   CDS             574113..574931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI3"
FT                   /locus_tag="NGR_c05170"
FT                   /product="NADH-enoyl acyl carrier protein reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24313"
FT                   /db_xref="GOA:C3MHI5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI5"
FT                   /protein_id="ACP24313.1"
FT                   /translation="MAQASGLMNGKRGVIMGVANNRSIAWGIAKALAEAGADIALTWQG
FT                   DALKKRVEPLAQELGAFMAGHCDVTDLATIDGVFSALEEKWGKIDFVVHAIAFSDKDEL
FT                   TGRYLDTSRDNFTRTMDISVYSFTAVAARAERIMNDGGSMLTLTYYGAEKVMPHYNVMG
FT                   VAKAALEASVRYLAVDLGNRGIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLKRT
FT                   VSIEEVGNSALYLLSNLSTGVTGEVHHVDSGYHTVGMKAVDAPDISVLKD"
     MAQASGLMNG KRGVIMGVAN NRSIAWGIAK ALAEAGADIA LTWQGDALKK RVEPLAQELG        60
     AFMAGHCDVT DLATIDGVFS ALEEKWGKID FVVHAIAFSD KDELTGRYLD TSRDNFTRTM       120
     DISVYSFTAV AARAERIMND GGSMLTLTYY GAEKVMPHYN VMGVAKAALE ASVRYLAVDL       180
     GNRGIRVNAI SAGPIKTLAA SGIGDFRYIL KWNEYNAPLK RTVSIEEVGN SALYLLSNLS       240
     TGVTGEVHHV DSGYHTVGMK AVDAPDISVL KD                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page