(data stored in ACNUC7421 zone)

EMBL: CP001389.FLAF

CP001389.FLAF        Location/Qualifiers
FT   CDS             336886..337233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="NGR_c02970"
FT                   /product="predicted flagellar protein FlaF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24095"
FT                   /db_xref="GOA:C3MG44"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG44"
FT                   /protein_id="ACP24095.1"
FT                   /translation="MYQFAYAEIMEEGVAVSKDREWQVLNRSIALLEAAKQQKGYSREA
FT                   IEAIYYTRRVWIRFIEDLRAPDNQLNDELRANLISIGIWILNETEKIRKRDSSNFQGII
FT                   DITTIIRDGLK"
     MYQFAYAEIM EEGVAVSKDR EWQVLNRSIA LLEAAKQQKG YSREAIEAIY YTRRVWIRFI        60
     EDLRAPDNQL NDELRANLIS IGIWILNETE KIRKRDSSNF QGIIDITTII RDGLK            115
//

If you have problems or comments...

PBIL Back to PBIL home page