(data stored in ACNUC7421 zone)

EMBL: CP001389.FLBT

CP001389.FLBT        Location/Qualifiers
FT   CDS             337230..337679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="NGR_c02980"
FT                   /product="predicted flagellum biosynthesis repressor
FT                   protein FlbT"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24096"
FT                   /db_xref="GOA:C3MG45"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG45"
FT                   /protein_id="ACP24096.1"
FT                   /translation="MKSTLRISLKSGERIFVNGAVLRVDRKVAVEFLNDVTFLLENHVL
FT                   QPEDATTPLRQLYFIAQMILINPEGAEQSTAMFRKSIVMLLACFKNEEVLAELKRIDGL
FT                   VTQGRAFEALKAIRGLYPIEERILNNQEITPATIDQIRKEIAPWR"
     MKSTLRISLK SGERIFVNGA VLRVDRKVAV EFLNDVTFLL ENHVLQPEDA TTPLRQLYFI        60
     AQMILINPEG AEQSTAMFRK SIVMLLACFK NEEVLAELKR IDGLVTQGRA FEALKAIRGL       120
     YPIEERILNN QEITPATIDQ IRKEIAPWR                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page