(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGB

CP001389.FLGB        Location/Qualifiers
FT   CDS             315625..316005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="NGR_c02740"
FT                   /product="putative flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24072"
FT                   /db_xref="GOA:C3MG21"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG21"
FT                   /protein_id="ACP24072.1"
FT                   /translation="MDPIQLFELASRQAQWLTVRQNVVAGNIANANTPHYRAKDVQPFE
FT                   SVLQNTGVQMAATHRAHFTESPDAAQVTDVGMIDDVAVQQSGNTVALEQEMMKTGEIKR
FT                   DYELNSGLVKSFHRMMLMTVRK"
     MDPIQLFELA SRQAQWLTVR QNVVAGNIAN ANTPHYRAKD VQPFESVLQN TGVQMAATHR        60
     AHFTESPDAA QVTDVGMIDD VAVQQSGNTV ALEQEMMKTG EIKRDYELNS GLVKSFHRMM       120
     LMTVRK                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page