(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGC

CP001389.FLGC        Location/Qualifiers
FT   CDS             316011..316430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="NGR_c02750"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24073"
FT                   /db_xref="GOA:C3MG22"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG22"
FT                   /protein_id="ACP24073.1"
FT                   /translation="MDPLTSALKVSASGLQAESTRLRIVSENIANARSTGDVPGADPYR
FT                   RKTISFAAEVDRASGASLVEVQRLGTDDSDFSIEFDPGNPAADEKGMVKMPNVNVLIEM
FT                   ADMREANRAYEANLQTVKQSRDLISQTIDLLRASQ"
     MDPLTSALKV SASGLQAEST RLRIVSENIA NARSTGDVPG ADPYRRKTIS FAAEVDRASG        60
     ASLVEVQRLG TDDSDFSIEF DPGNPAADEK GMVKMPNVNV LIEMADMREA NRAYEANLQT       120
     VKQSRDLISQ TIDLLRASQ                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page