(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGD

CP001389.FLGD        Location/Qualifiers
FT   CDS             337670..338116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="NGR_c02990"
FT                   /product="predicted flagellar hook capping protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24097"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG46"
FT                   /protein_id="ACP24097.1"
FT                   /translation="MAVSGVSSSASASTTSTTSTTSTSSTDAADATLNYQSFLKLLIAQ
FT                   MQNQDPTDPMDATEQISQLATFSQVEQSIKTNSNLESLLASESLTQASTYIGKTITSSD
FT                   GKTSGVVAEVEVTSDGVTAITTDGKEIAIETGISVSTTSSDSET"
     MAVSGVSSSA SASTTSTTST TSTSSTDAAD ATLNYQSFLK LLIAQMQNQD PTDPMDATEQ        60
     ISQLATFSQV EQSIKTNSNL ESLLASESLT QASTYIGKTI TSSDGKTSGV VAEVEVTSDG       120
     VTAITTDGKE IAIETGISVS TTSSDSET                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page