(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGE

CP001389.FLGE        Location/Qualifiers
FT   CDS             333127..334341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="NGR_c02940"
FT                   /product="putative flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24092"
FT                   /db_xref="GOA:C3MG41"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG41"
FT                   /protein_id="ACP24092.1"
FT                   /translation="MSLYGTMRTGVSGMNAQANRLSTVAENIANSSTTGYKRASTEFSS
FT                   MILPSSNGSYNSGGVETSVRYSISDQGSTTYTTSASDLAIDGDGFFIVQGANGQEYLTR
FT                   AGAFVQDDSGNLVNAAGFTLMGYEYEAGVDPTVVVNGFDGLTEVNLASDGLTAAGSTAG
FT                   AMGANLPSGAANGDVSTTSLVVYDTQGNTRILDFNYTKVADNQWELDIVDRTSATSLGT
FT                   ATLDFDADGVLTTSPATLTLDGTLISPITGTGAELNNITIDFTETTQLGTSFTPDGGSI
FT                   DGNAPSKVSGYQIDTDGVVYIKYANGELEPRYRIALASVQSPDKLVPESGNVYSQGVDS
FT                   GVIVTGFAGSGSFGEILSGALESSNVDIADELTSMIESQRNYTANSKVFQTGSELLEVL
FT                   VNLKR"
     MSLYGTMRTG VSGMNAQANR LSTVAENIAN SSTTGYKRAS TEFSSMILPS SNGSYNSGGV        60
     ETSVRYSISD QGSTTYTTSA SDLAIDGDGF FIVQGANGQE YLTRAGAFVQ DDSGNLVNAA       120
     GFTLMGYEYE AGVDPTVVVN GFDGLTEVNL ASDGLTAAGS TAGAMGANLP SGAANGDVST       180
     TSLVVYDTQG NTRILDFNYT KVADNQWELD IVDRTSATSL GTATLDFDAD GVLTTSPATL       240
     TLDGTLISPI TGTGAELNNI TIDFTETTQL GTSFTPDGGS IDGNAPSKVS GYQIDTDGVV       300
     YIKYANGELE PRYRIALASV QSPDKLVPES GNVYSQGVDS GVIVTGFAGS GSFGEILSGA       360
     LESSNVDIAD ELTSMIESQR NYTANSKVFQ TGSELLEVLV NLKR                        404
//

If you have problems or comments...

PBIL Back to PBIL home page