(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGF

CP001389.FLGF        Location/Qualifiers
FT   CDS             312598..313323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="NGR_c02710"
FT                   /product="Flagellar basal-body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24069"
FT                   /db_xref="GOA:C3MG18"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG18"
FT                   /protein_id="ACP24069.1"
FT                   /translation="MQTGLYVALSSQMALEKRLNTLADNIANANTVGFRSTEVKFDQVL
FT                   GDTKPSKVSYVSEGEEYLNTGNGALARTGSALDFAIKGNAWFNIDTPGGPALTRDGRFT
FT                   LTETGELVTLKGYPVLDAGGAPIQLNGGAGEITVGADGAIHQNGVQVALLGLYEADFSS
FT                   GFVRYDNSAVMPAAQPEPVVDRFDVGVMQGFLEESNVNAVQEMTQLIMVTRAFDNVTAL
FT                   MRDSEGSLEEAIKTLGGER"
     MQTGLYVALS SQMALEKRLN TLADNIANAN TVGFRSTEVK FDQVLGDTKP SKVSYVSEGE        60
     EYLNTGNGAL ARTGSALDFA IKGNAWFNID TPGGPALTRD GRFTLTETGE LVTLKGYPVL       120
     DAGGAPIQLN GGAGEITVGA DGAIHQNGVQ VALLGLYEAD FSSGFVRYDN SAVMPAAQPE       180
     PVVDRFDVGV MQGFLEESNV NAVQEMTQLI MVTRAFDNVT ALMRDSEGSL EEAIKTLGGE       240
     R                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page