(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGH

CP001389.FLGH        Location/Qualifiers
FT   CDS             319738..320448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="NGR_c02810"
FT                   /product="flagellar L-ring protein precursor (basal body
FT                   L-ring protein) FlgH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24079"
FT                   /db_xref="GOA:C3MG28"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG28"
FT                   /protein_id="ACP24079.1"
FT                   /translation="MRMQLTAVLAASLLAGCQNQAFREIGQAPSMSPIGSGLQYTQAPQ
FT                   LAAYPKQPHQMTAGYSLWNDQQAALFKDARAINVGDILTVDIQIDDKASFNNETDRSRT
FT                   NSSGFNLGASGESQTSDFEWSGNLKYGSNIKTEGDGKTERSEKLRLLVAAVVTGVLENG
FT                   NLLISGSQEVRVNHELRILNVAGIVRPRDVDADNIISYDRIAEARISYGGRGRLMEVQQ
FT                   PPWGQQVVDLVSPI"
     MRMQLTAVLA ASLLAGCQNQ AFREIGQAPS MSPIGSGLQY TQAPQLAAYP KQPHQMTAGY        60
     SLWNDQQAAL FKDARAINVG DILTVDIQID DKASFNNETD RSRTNSSGFN LGASGESQTS       120
     DFEWSGNLKY GSNIKTEGDG KTERSEKLRL LVAAVVTGVL ENGNLLISGS QEVRVNHELR       180
     ILNVAGIVRP RDVDADNIIS YDRIAEARIS YGGRGRLMEV QQPPWGQQVV DLVSPI           236
//

If you have problems or comments...

PBIL Back to PBIL home page