(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGK

CP001389.FLGK        Location/Qualifiers
FT   CDS             334363..335793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="NGR_c02950"
FT                   /product="predicted flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24093"
FT                   /db_xref="GOA:C3MG42"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG42"
FT                   /protein_id="ACP24093.1"
FT                   /translation="MSLSSAIAIAQSAFSTTASQTATVSKNVANASNADYSRRMAMLGT
FT                   TADGAQIVSIYRAQNEALLKQNLTSISQSSAQSSLLSGLELLKSALGGNDYETAPSTYL
FT                   SAFRDSLQTFASTPGNSTIAATVVADASDLANSISKTATAVQDLRLDTDKQIAEEVDNL
FT                   NALLASFETANNAVKQATATGADATAALDERDKLLKQLSELVGISTVTRADNDTVIYTS
FT                   DGTVLFETQARQVTFTATSAFDASTTGNAIFIDGVSLSAGAGADTTAEGKLASLLQLRD
FT                   DIAPTFQSQLDEMARGLVSLFQEDGAPGLFTWEDGTLPADGTVEPGIAATLSVNAAAQT
FT                   NPFLLRDGGFNGLVSNPGGATDPNSGYTDLLDGFITAMDGDMDFDAAAGLDSTSSIMEF
FT                   AASSIGWFEQIRSAASTADDNKTALLARTEEALGNVTGVSIDEELSLLLDLEQSYKASA
FT                   KLISTVDAMMASLLEAVR"
     MSLSSAIAIA QSAFSTTASQ TATVSKNVAN ASNADYSRRM AMLGTTADGA QIVSIYRAQN        60
     EALLKQNLTS ISQSSAQSSL LSGLELLKSA LGGNDYETAP STYLSAFRDS LQTFASTPGN       120
     STIAATVVAD ASDLANSISK TATAVQDLRL DTDKQIAEEV DNLNALLASF ETANNAVKQA       180
     TATGADATAA LDERDKLLKQ LSELVGISTV TRADNDTVIY TSDGTVLFET QARQVTFTAT       240
     SAFDASTTGN AIFIDGVSLS AGAGADTTAE GKLASLLQLR DDIAPTFQSQ LDEMARGLVS       300
     LFQEDGAPGL FTWEDGTLPA DGTVEPGIAA TLSVNAAAQT NPFLLRDGGF NGLVSNPGGA       360
     TDPNSGYTDL LDGFITAMDG DMDFDAAAGL DSTSSIMEFA ASSIGWFEQI RSAASTADDN       420
     KTALLARTEE ALGNVTGVSI DEELSLLLDL EQSYKASAKL ISTVDAMMAS LLEAVR           476
//

If you have problems or comments...

PBIL Back to PBIL home page