(data stored in ACNUC7421 zone)

EMBL: CP001389.FLGL

CP001389.FLGL        Location/Qualifiers
FT   CDS             335796..336848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="NGR_c02960"
FT                   /product="predicted flagellar hook-associated protein FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24094"
FT                   /db_xref="GOA:C3MG43"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG43"
FT                   /protein_id="ACP24094.1"
FT                   /translation="MKTSFVSNLAVQNAMRLTIQQGQEELLKLQTEVSTGRHADVGLEL
FT                   GSSTARSVNLQRELARLETLVDTNSVVTQRLASSQQALGTMAEAAEQVRNTLVTFKGND
FT                   SVDQLSVQKTEIESAMSLFTASANTSFNGEFLFAGINTDVKPFEDYAASGSAAKTTFDD
FT                   ALATYMSANGIASMSDFTEAQMEDFITNTLEPLYTDDAQWAGDWSAASSQNMTSRISTS
FT                   EVVQSSTNATTSGFRMFALASVISSELMDEDIGSEVRAYIGEASLGYVEQAITGLTAER
FT                   STLGISEARVEKANTSLEVQIKLINTHITDLEGVDTYDASTRMNTLLTQMETSYTLTGR
FT                   IQQLSLIDFL"
     MKTSFVSNLA VQNAMRLTIQ QGQEELLKLQ TEVSTGRHAD VGLELGSSTA RSVNLQRELA        60
     RLETLVDTNS VVTQRLASSQ QALGTMAEAA EQVRNTLVTF KGNDSVDQLS VQKTEIESAM       120
     SLFTASANTS FNGEFLFAGI NTDVKPFEDY AASGSAAKTT FDDALATYMS ANGIASMSDF       180
     TEAQMEDFIT NTLEPLYTDD AQWAGDWSAA SSQNMTSRIS TSEVVQSSTN ATTSGFRMFA       240
     LASVISSELM DEDIGSEVRA YIGEASLGYV EQAITGLTAE RSTLGISEAR VEKANTSLEV       300
     QIKLINTHIT DLEGVDTYDA STRMNTLLTQ METSYTLTGR IQQLSLIDFL                  350
//

If you have problems or comments...

PBIL Back to PBIL home page