(data stored in ACNUC7421 zone)

EMBL: CP001389.FLHA

CP001389.FLHA        Location/Qualifiers
FT   CDS             338666..340753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="NGR_c03010"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24099"
FT                   /db_xref="GOA:C3MG48"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG48"
FT                   /protein_id="ACP24099.1"
FT                   /translation="MAQQATLTIPKLAPKSRDIGFALGIVMILSILFLPIPPFLIDFGL
FT                   AFSIAFSVLILMVALWIQRPLEFSSFPTILLISTMTRLALNIATTRVILSHGHEGHGAA
FT                   GGVISGFASLVMSGDFVIGLIVFLILITVNFIVITKGATRIAEVGARFTLDAIPGKQMA
FT                   IDADLSAGLIDEKEAQRRRRELEEESSFFGAMDGASKFVRGDAIAGLIITAINIFGGII
FT                   IGYLRHDMPIGEAADVFVKLSVGDGLVSQIPALIVSLAAGLLVSRGGTAGSTDQAVVGQ
FT                   LSGYPRALMVAAGLIVMLSVMPGLPFVPFAVLGGGMAFLGWFIPRQIEAANAERRAQEA
FT                   EKAQQTKDSDKDSVKSVLKTAEIELLLGKQVSTRLLGAHQELAFRVGKMRRKFALQYGL
FT                   VVPEIKVSDDITIPDKAYHVRIHGTTIASNTVRVGEVLVVTGGGRRPSVPGDEIREPAF
FT                   GMPALSILETFTDDLKREGFHPIDNVSVVLTHLSEVIRNNLPQLLSYKDVKVLIERLDP
FT                   EYRKLADEICTSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEH
FT                   VRVRMSQQLCGDLAENGVLRVLRLGNKWDMVFHQALKRDAKGEIVEFDIDPRQLEEFSE
FT                   QATKVIREHLDRGVPFVLVSSPESRSYVRMIIERLFATLPVLSHVELAKGLEIKIIGAL
FT                   S"
     MAQQATLTIP KLAPKSRDIG FALGIVMILS ILFLPIPPFL IDFGLAFSIA FSVLILMVAL        60
     WIQRPLEFSS FPTILLISTM TRLALNIATT RVILSHGHEG HGAAGGVISG FASLVMSGDF       120
     VIGLIVFLIL ITVNFIVITK GATRIAEVGA RFTLDAIPGK QMAIDADLSA GLIDEKEAQR       180
     RRRELEEESS FFGAMDGASK FVRGDAIAGL IITAINIFGG IIIGYLRHDM PIGEAADVFV       240
     KLSVGDGLVS QIPALIVSLA AGLLVSRGGT AGSTDQAVVG QLSGYPRALM VAAGLIVMLS       300
     VMPGLPFVPF AVLGGGMAFL GWFIPRQIEA ANAERRAQEA EKAQQTKDSD KDSVKSVLKT       360
     AEIELLLGKQ VSTRLLGAHQ ELAFRVGKMR RKFALQYGLV VPEIKVSDDI TIPDKAYHVR       420
     IHGTTIASNT VRVGEVLVVT GGGRRPSVPG DEIREPAFGM PALSILETFT DDLKREGFHP       480
     IDNVSVVLTH LSEVIRNNLP QLLSYKDVKV LIERLDPEYR KLADEICTSH MSYSGLQAVL       540
     KLLLAERVSI RNLHLILEAV AELAPHVRKT EQIVEHVRVR MSQQLCGDLA ENGVLRVLRL       600
     GNKWDMVFHQ ALKRDAKGEI VEFDIDPRQL EEFSEQATKV IREHLDRGVP FVLVSSPESR       660
     SYVRMIIERL FATLPVLSHV ELAKGLEIKI IGALS                                  695
//

If you have problems or comments...

PBIL Back to PBIL home page