(data stored in ACNUC7421 zone)

EMBL: CP001389.FLHB

CP001389.FLHB        Location/Qualifiers
FT   CDS             complement(306825..307907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="NGR_c02650"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24063"
FT                   /db_xref="GOA:C3MG12"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG12"
FT                   /protein_id="ACP24063.1"
FT                   /translation="MSDDQDKDSKTEAPSEKKLSDAAEKGNVPFSREVTAFASTLAVYI
FT                   FIVFFLSDGAASTAEALKDIFEQPEAWRLETATDAVGLISHVVLKSAGLVLPVFVLLII
FT                   FGVGSSIFQNLPRPVLDRIMPNMNRVSPIAGFKRIFGVPGLVEFAKSLFKIIVVSIIVV
FT                   LVLWNDYFATLDLMFSDPVTIFATMISDLKQIVTVVLLATAVLAIVDLFWTRHHWYSEL
FT                   KMTKQEVKEELKQSQGDPIVKSRLRSMQRDRARKRMIASVPRATLVIANPTHYAVALRY
FT                   VREESDAPVVVAMGQDLVALKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYK
FT                   AVAELIHRVYAAQPQQKRVT"
     MSDDQDKDSK TEAPSEKKLS DAAEKGNVPF SREVTAFAST LAVYIFIVFF LSDGAASTAE        60
     ALKDIFEQPE AWRLETATDA VGLISHVVLK SAGLVLPVFV LLIIFGVGSS IFQNLPRPVL       120
     DRIMPNMNRV SPIAGFKRIF GVPGLVEFAK SLFKIIVVSI IVVLVLWNDY FATLDLMFSD       180
     PVTIFATMIS DLKQIVTVVL LATAVLAIVD LFWTRHHWYS ELKMTKQEVK EELKQSQGDP       240
     IVKSRLRSMQ RDRARKRMIA SVPRATLVIA NPTHYAVALR YVREESDAPV VVAMGQDLVA       300
     LKIREIAEKN GIPVFEDPPL ARSMFAQVSV DSVIPPVFYK AVAELIHRVY AAQPQQKRVT       360
//

If you have problems or comments...

PBIL Back to PBIL home page