(data stored in ACNUC7421 zone)

EMBL: CP001389.FLIE

CP001389.FLIE        Location/Qualifiers
FT   CDS             316430..316765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="NGR_c02760"
FT                   /product="predicted flagellar hook-basal body complex
FT                   protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24074"
FT                   /db_xref="GOA:C3MG23"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG23"
FT                   /protein_id="ACP24074.1"
FT                   /translation="MIDAIQSVGAFSNLKEAEGTSLTASTALSLPSAGASAPQSQSFAE
FT                   VLGTMTTDAIRSMKSAEGVSLQAIRGEANTREVVDAVMNAEQSLQTALAIRDKVVTAYL
FT                   EIARMQI"
     MIDAIQSVGA FSNLKEAEGT SLTASTALSL PSAGASAPQS QSFAEVLGTM TTDAIRSMKS        60
     AEGVSLQAIR GEANTREVVD AVMNAEQSLQ TALAIRDKVV TAYLEIARMQ I                111
//

If you have problems or comments...

PBIL Back to PBIL home page